Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PRL7A2 Peptide - middle region

PRL7A2 Peptide - middle region

Product Specifications

Product Name Alternative

Ghd18, PLP-F, Prlpf

UniProt

Q9R006

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_035298.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TYTVNQVSEKLYENYMLDFIEDMEYLVKALTCCHNYSIKTPENLDEAQQI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KRTAP5-6 (NM_001012416) Human Over-expression Lysate
LS440023-100ug 100 µg

KRTAP5-6 (NM_001012416) Human Over-expression Lysate

Sign In for Pricing
View Details
Rabbit Anti-Dog IgG (H&L) - Alexa Fluor 405
MBS4517055-01 0.1 mL

Rabbit Anti-Dog IgG (H&L) - Alexa Fluor 405

Sign In for Pricing
View Details
Rabbit Anti-Dog IgG (H&L) - Alexa Fluor 405
MBS4517055-02 0.5 mL

Rabbit Anti-Dog IgG (H&L) - Alexa Fluor 405

Sign In for Pricing
View Details
Rabbit Anti-Dog IgG (H&L) - Alexa Fluor 405
MBS4517055-03 1 mL

Rabbit Anti-Dog IgG (H&L) - Alexa Fluor 405

Sign In for Pricing
View Details
Rabbit Anti-Dog IgG (H&L) - Alexa Fluor 405
MBS4517055-04 5x 1 mL

Rabbit Anti-Dog IgG (H&L) - Alexa Fluor 405

Sign In for Pricing
View Details
Super Fluor 750, SE
TD0030 1 mg

Super Fluor 750, SE

Sign In for Pricing
View Details