Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PRL7A2 Peptide - middle region

PRL7A2 Peptide - middle region

Product Specifications

Product Name Alternative

Ghd18, PLP-F, Prlpf

UniProt

Q9R006

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_035298.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TYTVNQVSEKLYENYMLDFIEDMEYLVKALTCCHNYSIKTPENLDEAQQI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD52 Human Gene Knockout Kit (CRISPR)
KN400493 1 Kit

CD52 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
MEK1 (MAP2K1) pSer218/221 Rabbit Polyclonal Antibody
AP12640PU-N 400 µL

MEK1 (MAP2K1) pSer218/221 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CD44v4 (Marker of Tumor Metastasis), CF594 conjugate, 0.1mg/mL
BNC941751-500 1x 500 µL

CD44v4 (Marker of Tumor Metastasis), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ATP6V1A (NM_001690) Human Over-expression Lysate
LC419783 20 µg

ATP6V1A (NM_001690) Human Over-expression Lysate

Sign In for Pricing
View Details
SCYL1BP1 (GORAB) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2D1]
TA800286AM 100 µL

SCYL1BP1 (GORAB) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2D1]

Sign In for Pricing
View Details
IRS1 Rabbit Polyclonal Antibody
AP20694PU-N 100 µg

IRS1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details