Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CAMKV Peptide - middle region

CAMKV Peptide - middle region

Product Specifications

Product Name Alternative

CaM kinase-like vesicle-associated protein

UniProt

Q8NCB2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001307076.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: IMYILLSGNPPFYEEVEEDDYENHDKNLFRKILAGDYEFDSPYWDDISQA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Mesothelin-coupled Magnetic Beads
MBS-K024-10mg 10 mg

Human Mesothelin-coupled Magnetic Beads

Sign In for Pricing
View Details
HFE2 Antibody - middle region
OAAB06297-400UL 400 µL

HFE2 Antibody - middle region

Sign In for Pricing
View Details
Klf10 Mouse qPCR Primer Pair (NM_013692)
MP207216 200 Reactions

Klf10 Mouse qPCR Primer Pair (NM_013692)

Sign In for Pricing
View Details
Recombinant Human IRF8 protein
MBS1561577-01 0.05 mg

Recombinant Human IRF8 protein

Sign In for Pricing
View Details
Recombinant Human IRF8 protein
MBS1561577-02 0.1 mg

Recombinant Human IRF8 protein

Sign In for Pricing
View Details
Recombinant Human IRF8 protein
MBS1561577-03 5x 0.1 mg

Recombinant Human IRF8 protein

Sign In for Pricing
View Details