What is the catalog number for CAMKV Peptide - middle region?

The catalog number for CAMKV Peptide - middle region is orb1998092.

What sizes are available for CAMKV Peptide - middle region?

CAMKV Peptide - middle region is available in the following size(s): 100 µg.

Is CAMKV Peptide - middle region in stock?

CAMKV Peptide - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

CAMKV Peptide - middle region

Product Specifications

Product Name Alternative

CaM kinase-like vesicle-associated protein

UniProt

Q8NCB2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001307076.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: IMYILLSGNPPFYEEVEEDDYENHDKNLFRKILAGDYEFDSPYWDDISQA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

S7242-200mg 200 mg

Erastin

Sign In for Pricing

View Details

RR209932L3 10 µg

Dapk2 (NM_001013109) Rat Tagged Lenti ORF Clone

Sign In for Pricing

View Details

sc-119940 100 µg - 200 µL

EF-Ts (m) : 293T Lysate

Sign In for Pricing

View Details

MBS2152676-01 0.1 mL

Monoclonal Antibody to Aspartate Aminotransferase 2 (AST2)

Sign In for Pricing

View Details

MBS2152676-02 0.2 mL

Monoclonal Antibody to Aspartate Aminotransferase 2 (AST2)

Sign In for Pricing

View Details

MBS2152676-03 0.5 mL

Monoclonal Antibody to Aspartate Aminotransferase 2 (AST2)

Sign In for Pricing

View Details