What is the catalog number for RAB28 Peptide - middle region?

The catalog number for RAB28 Peptide - middle region is orb1998086.

What sizes are available for RAB28 Peptide - middle region?

RAB28 Peptide - middle region is available in the following size(s): 100 µg.

Is RAB28 Peptide - middle region in stock?

RAB28 Peptide - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

RAB28 Peptide - middle region

Product Specifications

Product Name Alternative

CORD18

UniProt

P51157

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001017979.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ASGKTSLTTCFAQETFGKQYKQTIGLDFFLRRITLPGNLNVTLQIWDIGG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

JBS-NU-948 1 μmoL

3′- (O-Propargyl) -UTP

Sign In for Pricing

View Details

sc-416425-HDR 20 µg

NOC3L HDR Plasmid (h)

Sign In for Pricing

View Details

HY-P703337 1 Each

NLRP2, Human (sf9)

Sign In for Pricing

View Details

orb3066005-01 25 Tests

PE human CD31 Antibody

Sign In for Pricing

View Details

orb3066005-02 100 Tests

PE human CD31 Antibody

Sign In for Pricing

View Details

SMART-SPT8R each

SMART-SPOT, 8 analyte sentinel panel, rat serum, 8 Tests/Kit

Sign In for Pricing

View Details