Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LINS1 Peptide - middle region

LINS1 Peptide - middle region

Product Specifications

Product Name Alternative

Protein Lines homolog 1

UniProt

Q8NG48

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001035706.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TAIIKEIFKDSCSQKTEILKQFLTHFDTIFEVFYNSLFSQHFENCRDTSK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Protein Z Dependent Protease Inhibitor (ZPI) Mouse ELISA Kit
G4529 96 Tests

Protein Z Dependent Protease Inhibitor (ZPI) Mouse ELISA Kit

Sign In for Pricing
View Details
Claudin 1 (CLDN1) (MaxLight 405)
MBS6469224-01 0.1 mL

Claudin 1 (CLDN1) (MaxLight 405)

Sign In for Pricing
View Details
Claudin 1 (CLDN1) (MaxLight 405)
MBS6469224-02 5x 0.1 mL

Claudin 1 (CLDN1) (MaxLight 405)

Sign In for Pricing
View Details
CPNE1 Rabbit pAb, BF700 conjugated
orb2882274 100 µL

CPNE1 Rabbit pAb, BF700 conjugated

Sign In for Pricing
View Details
Human COMT qPCR Primer Pair
QH12317S 200 Tests

Human COMT qPCR Primer Pair

Sign In for Pricing
View Details
HSD11B1L siRNA (Human)
orb1850626-01 15 nmol

HSD11B1L siRNA (Human)

Sign In for Pricing
View Details