Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

USP14 Peptide - C-terminal region

USP14 Peptide - C-terminal region

Product Specifications

Product Name Alternative

TGT

UniProt

P54578

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001032411.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DEWIKFDDDKVSIVTPEDILRLSGGGDWHIAYVLLYGPRRVEIMEEESEQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Prrt1 Rat siRNA Oligo Duplex (Locus ID 406167)
SR504661 1 Kit

Prrt1 Rat siRNA Oligo Duplex (Locus ID 406167)

Sign In for Pricing
View Details
H2ac15 Mouse shRNA Lentiviral Particle (Locus ID 319169)
TL519822V 500 µL Each

H2ac15 Mouse shRNA Lentiviral Particle (Locus ID 319169)

Sign In for Pricing
View Details
RAB30 Rabbit Polyclonal Antibody (BF350)
orb2466546 100 µL

RAB30 Rabbit Polyclonal Antibody (BF350)

Sign In for Pricing
View Details
SEC11A (NM_001271918) Human Tagged ORF Clone
RC231865 10 µg

SEC11A (NM_001271918) Human Tagged ORF Clone

Sign In for Pricing
View Details
MIR1269A Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
LV767903 1.0 µg DNA

MIR1269A Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
3-Hydroxy-N-phenylaniline
orb1987261-01 100 mg

3-Hydroxy-N-phenylaniline

Sign In for Pricing
View Details