GTPBP3 Peptide - middle region
GTPBP3 Peptide - middle region
Product Specifications
Product Name Alternative
TRNA modification GTPase GTPBP3, mitochondrial
UniProt
Q969Y2
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_001122327.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: LREGVGPVEQEGVRRARERLEQADLILAMLDASDLASPSSCNFLATVVAS
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS9246909-01 0.1 mg
Anti-TNFRSF8/CD30 Reference Antibody (brentuximab)
Sign In for Pricing
View Details MBS9246909-02 5x 0.1 mg
Anti-TNFRSF8/CD30 Reference Antibody (brentuximab)
Sign In for Pricing
View Details 
GTR15119109 1 Vial
Lentiviral mouse Pcdhb22 shRNA (UAS) - Lentiviral mouse Pcdhb22 shRNA (UAS, GFP) (100)
Sign In for Pricing
View Details MBS6172999-01 0.1 mL
WDR5 (WD Repeat Domain 5, BIG-3, SWD3) (Biotin)
Sign In for Pricing
View Details MBS6172999-02 5x 0.1 mL
WDR5 (WD Repeat Domain 5, BIG-3, SWD3) (Biotin)
Sign In for Pricing
View Details