Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GTPBP3 Peptide - middle region

GTPBP3 Peptide - middle region

Product Specifications

Product Name Alternative

TRNA modification GTPase GTPBP3, mitochondrial

UniProt

Q969Y2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001122327.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LREGVGPVEQEGVRRARERLEQADLILAMLDASDLASPSSCNFLATVVAS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Safflospermidine B
TN6556 5 mg

Safflospermidine B

Sign In for Pricing
View Details
DAB 50x concentrate
DABM-500 500 mL

DAB 50x concentrate

Sign In for Pricing
View Details
SH2D3C (SH2 Domain Containing 3C, CHAT, FLJ39664, NSP3, PRO34088) (Biotin)
251618-Biotin 100 µL

SH2D3C (SH2 Domain Containing 3C, CHAT, FLJ39664, NSP3, PRO34088) (Biotin)

Sign In for Pricing
View Details
Rat ELN (Elastin) ELISA Kit
ELK5957-01 48 Tests

Rat ELN (Elastin) ELISA Kit

Sign In for Pricing
View Details
Rat ELN (Elastin) ELISA Kit
ELK5957-02 96 Tests

Rat ELN (Elastin) ELISA Kit

Sign In for Pricing
View Details
Rat ELN (Elastin) ELISA Kit
ELK5957-03 5x 96 Tests

Rat ELN (Elastin) ELISA Kit

Sign In for Pricing
View Details