Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ATP1A2 Peptide - N-terminal region

ATP1A2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

FHM2, MHP2

UniProt

P50993

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_000693.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TTPEWVKFCRQLFGGFSILLWIGAILCFLAYGIQAAMEDEPSNDNLYLGV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Lung
CS624340 5x 5 µm

Frozen Tissue Sections, Lung

Sign In for Pricing
View Details
2-(2-Hydroxyphenyl)-4H-1,3-benzoxazin-4-one-d4 (Mixture of 2-Hydroxyphenyl-d4 & Benzoxazinone-d4)
TRC-H951242-25MG 25 mg

2-(2-Hydroxyphenyl)-4H-1,3-benzoxazin-4-one-d4 (Mixture of 2-Hydroxyphenyl-d4 & Benzoxazinone-d4)

Sign In for Pricing
View Details
Recombinant CD64 Antibody
RC-5035-01 50 μL

Recombinant CD64 Antibody

Sign In for Pricing
View Details
Recombinant CD64 Antibody
RC-5035-02 100 µL

Recombinant CD64 Antibody

Sign In for Pricing
View Details
Recombinant CD64 Antibody
RC-5035-03 1 mL

Recombinant CD64 Antibody

Sign In for Pricing
View Details
PE/Cyanine7 Anti-Mouse CD326/EpCAM Antibody[G8.8]
E-AB-F1181UH-01 25 µg

PE/Cyanine7 Anti-Mouse CD326/EpCAM Antibody[G8.8]

Sign In for Pricing
View Details