Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ATP1A2 Peptide - N-terminal region

ATP1A2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

FHM2, MHP2

UniProt

P50993

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_000693.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TTPEWVKFCRQLFGGFSILLWIGAILCFLAYGIQAAMEDEPSNDNLYLGV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant PAK2 Antibody
RC-5243-01 50 μL

Recombinant PAK2 Antibody

Sign In for Pricing
View Details
Recombinant PAK2 Antibody
RC-5243-02 100 µL

Recombinant PAK2 Antibody

Sign In for Pricing
View Details
Recombinant PAK2 Antibody
RC-5243-03 1 mL

Recombinant PAK2 Antibody

Sign In for Pricing
View Details
Tissue FFPE Sections, Tongue
CS708376 5x 5 µm

Tissue FFPE Sections, Tongue

Sign In for Pricing
View Details
B-D-Threo-thymidylyl-(3'→5')-B-D-threo-thymidine-13C2 Ammonia Salt
TRC-H423412-1MG 1 mg

B-D-Threo-thymidylyl-(3'→5')-B-D-threo-thymidine-13C2 Ammonia Salt

Sign In for Pricing
View Details
2-Mercapto-succinic Acid diethyl ester
TRC-M726125-50MG 50 mg

2-Mercapto-succinic Acid diethyl ester

Sign In for Pricing
View Details