HSDL2 Peptide - middle region
HSDL2 Peptide - middle region
Product Specifications
Product Name Alternative
C9orf99, SDR13C1
UniProt
Q6YN16
Field of Research
Metabolism Research
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_001182751.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: KTAQPHPKLLGTIYTAAEEIEAVGGKALPCIVDVRDEQQISAAVEKAIKK
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
19630154 3x 1.0 µg DNA
F9 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)
Sign In for Pricing
View Details MBS1458538-01 0.02 mg (E-Coli)
Recombinant Bacillus anthracis Phosphoadenosine phosphosulfate reductase (cysH)
Sign In for Pricing
View Details MBS1458538-02 0.1 mg (E-Coli)
Recombinant Bacillus anthracis Phosphoadenosine phosphosulfate reductase (cysH)
Sign In for Pricing
View Details MBS1458538-03 0.02 mg (Yeast)
Recombinant Bacillus anthracis Phosphoadenosine phosphosulfate reductase (cysH)
Sign In for Pricing
View Details MBS1458538-04 0.1 mg (Yeast)
Recombinant Bacillus anthracis Phosphoadenosine phosphosulfate reductase (cysH)
Sign In for Pricing
View Details