HSDL2 Peptide - middle region
HSDL2 Peptide - middle region
Product Specifications
Product Name Alternative
C9orf99, SDR13C1
UniProt
Q6YN16
Field of Research
Metabolism Research
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_001182751.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: KTAQPHPKLLGTIYTAAEEIEAVGGKALPCIVDVRDEQQISAAVEKAIKK
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
K7180903 1.0 µg DNA
Gimap5 sgRNA CRISPR Lentivector (Rat) (Target 2)
Sign In for Pricing
View Details OR1074077-01 50 mg
Sodium 4,5-bis (diphenylphosphino) -9,9-dimethyl-9H-xanthene-2,7-disulfonate
Sign In for Pricing
View Details OR1074077-02 100 mg
Sodium 4,5-bis (diphenylphosphino) -9,9-dimethyl-9H-xanthene-2,7-disulfonate
Sign In for Pricing
View Details OR1074077-03 250 mg
Sodium 4,5-bis (diphenylphosphino) -9,9-dimethyl-9H-xanthene-2,7-disulfonate
Sign In for Pricing
View Details OR1074077-04 1 g
Sodium 4,5-bis (diphenylphosphino) -9,9-dimethyl-9H-xanthene-2,7-disulfonate
Sign In for Pricing
View Details OR1074077-05 5 g
Sodium 4,5-bis (diphenylphosphino) -9,9-dimethyl-9H-xanthene-2,7-disulfonate
Sign In for Pricing
View Details