Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TBCC Peptide - C-terminal region

TBCC Peptide - C-terminal region

Product Specifications

Product Name Alternative

CFC

UniProt

Q15814

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_003183.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: HSTKDTRIFLQVTSRAIVEDCSGIQFAPYTWSYPEIDKDFESSGLDRSKN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AKT3 (NM_181690) Human Recombinant Protein
TP324750M 100 µg

AKT3 (NM_181690) Human Recombinant Protein

Sign In for Pricing
View Details
WDR8 (WRAP73) (NM_017818) Human Recombinant Protein
TP310272L 1 mg

WDR8 (WRAP73) (NM_017818) Human Recombinant Protein

Sign In for Pricing
View Details
Tissue FFPE Sections, Colon: rectosigmoid
CS702597 5x 5 µm

Tissue FFPE Sections, Colon: rectosigmoid

Sign In for Pricing
View Details
NONO Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2C9]
TA504830BM 100 µL

NONO Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2C9]

Sign In for Pricing
View Details
Tissue Total RNA, Pancreas
CR563048 5 µg

Tissue Total RNA, Pancreas

Sign In for Pricing
View Details
CACNA2D1 Rabbit Polyclonal Antibody
AP05136PU-N 100 µg

CACNA2D1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details