Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TBCC Peptide - C-terminal region

TBCC Peptide - C-terminal region

Product Specifications

Product Name Alternative

CFC

UniProt

Q15814

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_003183.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: HSTKDTRIFLQVTSRAIVEDCSGIQFAPYTWSYPEIDKDFESSGLDRSKN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Elab Fluor® 488 Anti-Mouse CD122/IL-2RB Antibody[5H4]
E-AB-F1029L-01 50 Tests

Elab Fluor® 488 Anti-Mouse CD122/IL-2RB Antibody[5H4]

Sign In for Pricing
View Details
Elab Fluor® 488 Anti-Mouse CD122/IL-2RB Antibody[5H4]
E-AB-F1029L-02 100 Tests

Elab Fluor® 488 Anti-Mouse CD122/IL-2RB Antibody[5H4]

Sign In for Pricing
View Details
Elab Fluor® 488 Anti-Mouse CD122/IL-2RB Antibody[5H4]
E-AB-F1029L-03 2x 100 Tests

Elab Fluor® 488 Anti-Mouse CD122/IL-2RB Antibody[5H4]

Sign In for Pricing
View Details
SYCE3 (NM_001123225) Human Recombinant Protein
TP325004M 100 µg

SYCE3 (NM_001123225) Human Recombinant Protein

Sign In for Pricing
View Details
Ubiquilin (UBQLN1) (NM_013438) Human Over-expression Lysate
LC402265 20 µg

Ubiquilin (UBQLN1) (NM_013438) Human Over-expression Lysate

Sign In for Pricing
View Details
CYBA (C-term) Rabbit Polyclonal Antibody
AP51159PU-N 400 µL

CYBA (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details