Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PRKG1 Peptide - C-terminal region

PRKG1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

PKG, cGK, AAT8, cGK1, cGKI, cGK 1, PRKG1B, PRKGR1B, cGKI-BETA, cGKI-alpha

UniProt

Q13976

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001091982.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KWFEGFNWEGLRKGTLTPPIIPSVASPTDTSNFDSFPEDNDEPPPDDNSG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human MCT7 (SLC16A6) activation kit by CRISPRa
GA106073 1 Kit

Human MCT7 (SLC16A6) activation kit by CRISPRa

Sign In for Pricing
View Details
Frozen Tissue Sections, Urinary bladder
CS508773 5x 5 µm

Frozen Tissue Sections, Urinary bladder

Sign In for Pricing
View Details
LRRC32 (NM_001128922) Human Over-expression Lysate
LC427024 20 µg

LRRC32 (NM_001128922) Human Over-expression Lysate

Sign In for Pricing
View Details
GSTO1 Polyclonal Antibody
E-AB-11285-01 20 µL

GSTO1 Polyclonal Antibody

Sign In for Pricing
View Details
GSTO1 Polyclonal Antibody
E-AB-11285-02 60 µL

GSTO1 Polyclonal Antibody

Sign In for Pricing
View Details
GSTO1 Polyclonal Antibody
E-AB-11285-03 120 µL

GSTO1 Polyclonal Antibody

Sign In for Pricing
View Details