Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PRKG1 Peptide - C-terminal region

PRKG1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

PKG, cGK, AAT8, cGK1, cGKI, cGK 1, PRKG1B, PRKGR1B, cGKI-BETA, cGKI-alpha

UniProt

Q13976

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001091982.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KWFEGFNWEGLRKGTLTPPIIPSVASPTDTSNFDSFPEDNDEPPPDDNSG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Protein A Coated - 96 well plates - 8 Well Strips on 12 x 8 frame - White PS
MTW06F4-PA 10x 96 Well Plates

Protein A Coated - 96 well plates - 8 Well Strips on 12 x 8 frame - White PS

Sign In for Pricing
View Details
Fluorinert FC 40 (Technical Grade)
TRC-F485808-50G 50 g

Fluorinert FC 40 (Technical Grade)

Sign In for Pricing
View Details
ELOC (C-term) Rabbit Polyclonal Antibody
AP54199PU-N 400 µL

ELOC (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ENTPD3 Polyclonal Antibody
E-AB-65768-01 60 µL

ENTPD3 Polyclonal Antibody

Sign In for Pricing
View Details
ENTPD3 Polyclonal Antibody
E-AB-65768-02 120 µL

ENTPD3 Polyclonal Antibody

Sign In for Pricing
View Details
ENTPD3 Polyclonal Antibody
E-AB-65768-03 200 µL

ENTPD3 Polyclonal Antibody

Sign In for Pricing
View Details