Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AMBRA1 Peptide - C-terminal region

AMBRA1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

Activating molecule in BECN1-regulated autophagy protein 1

UniProt

A2AH22

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001074223.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ERTVGVAFNQETGHWERIYTQSSRSGTVSQEALHQDMPEESSEEDSLRRL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tide Quencher™ 3 alkyne [TQ3 alkyne]
2232-AAT 5 mg

Tide Quencher™ 3 alkyne [TQ3 alkyne]

Sign In for Pricing
View Details
Mouse Prenylcysteine Oxidase 1 (PCYOX1) ELISA Kit
RDR-PCYOX1-Mu-01 96 Tests

Mouse Prenylcysteine Oxidase 1 (PCYOX1) ELISA Kit

Sign In for Pricing
View Details
Mouse Prenylcysteine Oxidase 1 (PCYOX1) ELISA Kit
RDR-PCYOX1-Mu-02 48 Tests

Mouse Prenylcysteine Oxidase 1 (PCYOX1) ELISA Kit

Sign In for Pricing
View Details
Frozen Tissue Sections, Prostate
CS634054 5x 5 µm

Frozen Tissue Sections, Prostate

Sign In for Pricing
View Details
RIT1 Mouse Monoclonal Antibody [Clone ID: 14G7]
AM05290PU-N 100 µg

RIT1 Mouse Monoclonal Antibody [Clone ID: 14G7]

Sign In for Pricing
View Details
Sumo 2 (SUMO2) (+ SUMO3) Mouse Monoclonal Antibody [Clone ID: SM23/496]
AM50309PU-S 100 µg

Sumo 2 (SUMO2) (+ SUMO3) Mouse Monoclonal Antibody [Clone ID: SM23/496]

Sign In for Pricing
View Details