Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AMBRA1 Peptide - C-terminal region

AMBRA1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

Activating molecule in BECN1-regulated autophagy protein 1

UniProt

A2AH22

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001074223.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ERTVGVAFNQETGHWERIYTQSSRSGTVSQEALHQDMPEESSEEDSLRRL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human ILT6/LILRA3 Protein (Fc Tag)
PKSH030602 100 µg

Recombinant Human ILT6/LILRA3 Protein (Fc Tag)

Sign In for Pricing
View Details
Cytokeratin 20 Recombinant Rabbit monoclonal Antibody
HA750026 100 µL

Cytokeratin 20 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Mono(2-ethyl-5-hexenyl) Phthalate
TRC-M542495-50MG 50 mg

Mono(2-ethyl-5-hexenyl) Phthalate

Sign In for Pricing
View Details
C2orf89 (TRABD2A) (NM_001080824) Human Over-expression Lysate
LY421116 100 µg

C2orf89 (TRABD2A) (NM_001080824) Human Over-expression Lysate

Sign In for Pricing
View Details
JNJ 42041935
TRC-J211318-1MG 1 mg

JNJ 42041935

Sign In for Pricing
View Details
Ubiquitin (Autophagy Marker) (UBB/1748), CF640R conjugate, 0.1mg/mL
BNC401748-100 1x 100 µL

Ubiquitin (Autophagy Marker) (UBB/1748), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details