DUSP26 Peptide - middle region
DUSP26 Peptide - middle region
Product Specifications
Product Name Alternative
Dual specificity protein phosphatase 26
UniProt
Q9D700
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_080145.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: TACNHADEVWPGLYLGDQDMANNRRELRRLGITHVLNASHNRWRGTPEAY
More Discoveries
Explore Other Products
Browse additional items from our catalog
SYP-H0628-01 48 Well
Human LRG1(Leucine Rich Alpha-2-Glycoprotein 1) ELISA Kit
Sign In for Pricing
View Details SYP-H0628-02 96 Well
Human LRG1(Leucine Rich Alpha-2-Glycoprotein 1) ELISA Kit
Sign In for Pricing
View Details GTR15388321 1 Vial
Lentiviral human TSFM sgRNA gene knockout kit - Lentiviral human TSFM sgRNA gene knockout kit (100)
Sign In for Pricing
View Details