Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PSEN2 Peptide - middle region

PSEN2 Peptide - middle region

Product Specifications

Product Name Alternative

Presenilin-2

UniProt

Q61144

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001122077.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ALVFIKYLPEWSAWVILGAISVYDLVAVLCPKGPLRMLVETAQERNEPIF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-OR3A2 Antibody
CQA9617-01 30 µL

Anti-OR3A2 Antibody

Sign In for Pricing
View Details
Anti-OR3A2 Antibody
CQA9617-02 50 μL

Anti-OR3A2 Antibody

Sign In for Pricing
View Details
Anti-OR3A2 Antibody
CQA9617-03 100 µL

Anti-OR3A2 Antibody

Sign In for Pricing
View Details
Anti-OR3A2 Antibody
CQA9617-04 200 µL

Anti-OR3A2 Antibody

Sign In for Pricing
View Details
Sema4f (NM_011350) Mouse Tagged Lenti ORF Clone
MR210594L3 10 µg

Sema4f (NM_011350) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
4933407H18Rik Protein Vector (Mouse) (pPM-C-His)
PV149709 500 ng

4933407H18Rik Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details