PSEN2 Peptide - middle region
PSEN2 Peptide - middle region
Product Specifications
Product Name Alternative
Presenilin-2
UniProt
Q61144
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_001122077.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: ALVFIKYLPEWSAWVILGAISVYDLVAVLCPKGPLRMLVETAQERNEPIF
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS1483096-01 0.02 mg (E-Coli)
Recombinant Chlamydomonas reinhardtii Delta-aminolevulinic acid dehydratase, chloroplastic (HEMB)
Sign In for Pricing
View Details MBS1483096-02 0.02 mg (Yeast)
Recombinant Chlamydomonas reinhardtii Delta-aminolevulinic acid dehydratase, chloroplastic (HEMB)
Sign In for Pricing
View Details MBS1483096-03 0.1 mg (E-Coli)
Recombinant Chlamydomonas reinhardtii Delta-aminolevulinic acid dehydratase, chloroplastic (HEMB)
Sign In for Pricing
View Details MBS1483096-04 0.1 mg (Yeast)
Recombinant Chlamydomonas reinhardtii Delta-aminolevulinic acid dehydratase, chloroplastic (HEMB)
Sign In for Pricing
View Details MBS1483096-05 0.02 mg (Baculovirus)
Recombinant Chlamydomonas reinhardtii Delta-aminolevulinic acid dehydratase, chloroplastic (HEMB)
Sign In for Pricing
View Details MBS1483096-06 0.02 mg (Mammalian-Cell)
Recombinant Chlamydomonas reinhardtii Delta-aminolevulinic acid dehydratase, chloroplastic (HEMB)
Sign In for Pricing
View Details