Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RECK Peptide - N-terminal region

RECK Peptide - N-terminal region

Product Specifications

Product Name Alternative

St15, mRECK

UniProt

Q9Z0J1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_057887.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: MNSSLPGVFKKSDGWVGLGCCELAIGLECRQACKQASSKNDISKVCRKEY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cowaxanthone B
AB2474 10 mg

Cowaxanthone B

Sign In for Pricing
View Details
Aurkc Rat shRNA Plasmid (Locus ID 292554)
TR704808 1 Kit

Aurkc Rat shRNA Plasmid (Locus ID 292554)

Sign In for Pricing
View Details
Shbg (NM_011367) Mouse Recombinant Protein
PM43890M5 20 µg

Shbg (NM_011367) Mouse Recombinant Protein

Sign In for Pricing
View Details
Recombinant VZV Protein, GMP Grade
VZV-180THP 10 µg

Recombinant VZV Protein, GMP Grade

Sign In for Pricing
View Details
TRNAM10 3'UTR Lenti-reporter-Luc Vector
48196081 1.0 µg

TRNAM10 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
Recombinant Yersinia pseudotuberculosis Holo-[acyl-carrier-protein] synthase (acpS)
MBS1342944-01 0.02 mg (E-Coli)

Recombinant Yersinia pseudotuberculosis Holo-[acyl-carrier-protein] synthase (acpS)

Sign In for Pricing
View Details