Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RECK Peptide - N-terminal region

RECK Peptide - N-terminal region

Product Specifications

Product Name Alternative

St15, mRECK

UniProt

Q9Z0J1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_057887.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: MNSSLPGVFKKSDGWVGLGCCELAIGLECRQACKQASSKNDISKVCRKEY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PCSK4 Polyclonal Antibody, PE Conjugated
bs-15501R-PE 100 µL

PCSK4 Polyclonal Antibody, PE Conjugated

Sign In for Pricing
View Details
Myf6 Rabbit pAb, PE-Cy5.5 conjugated
orb2854962 100 µL

Myf6 Rabbit pAb, PE-Cy5.5 conjugated

Sign In for Pricing
View Details
Comfort MTP (HxD) 13x6=78 plates 16mm, 228x540x135mm
TE35522 1 Piece

Comfort MTP (HxD) 13x6=78 plates 16mm, 228x540x135mm

Sign In for Pricing
View Details
Iron (II) carbonate
89994425-1kg 1 Kg

Iron (II) carbonate

Sign In for Pricing
View Details
NR1H2 Blocking Peptide
MBS9620831-01 1 mg

NR1H2 Blocking Peptide

Sign In for Pricing
View Details
NR1H2 Blocking Peptide
MBS9620831-02 5x 1 mg

NR1H2 Blocking Peptide

Sign In for Pricing
View Details