Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PPM1G Peptide - middle region

PPM1G Peptide - middle region

Product Specifications

Product Name Alternative

Protein phosphatase 1G

UniProt

Q61074

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_032040.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QSKISQRDENGELRLLSSIVEELLDQCLAPDTSGDGTGCDNMTCIIICFK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Skin
CS626435 5x 5 µm

Frozen Tissue Sections, Skin

Sign In for Pricing
View Details
RANKL (TNFSF11) (NM_003701) Human Over-expression Lysate
LY401221 100 µg

RANKL (TNFSF11) (NM_003701) Human Over-expression Lysate

Sign In for Pricing
View Details
FITC Conjugated Griffonia simplicifolia Lectin -GS-I-B4 -
F-2401-B-1 1 mg

FITC Conjugated Griffonia simplicifolia Lectin -GS-I-B4 -

Sign In for Pricing
View Details
1-Acetyl-2-piperidineacetic Acid
TRC-A192815-500MG 500 mg

1-Acetyl-2-piperidineacetic Acid

Sign In for Pricing
View Details
PLCL2 Polyclonal Antibody
E-AB-18878-01 20 µL

PLCL2 Polyclonal Antibody

Sign In for Pricing
View Details
PLCL2 Polyclonal Antibody
E-AB-18878-02 60 µL

PLCL2 Polyclonal Antibody

Sign In for Pricing
View Details