Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PPM1G Peptide - middle region

PPM1G Peptide - middle region

Product Specifications

Product Name Alternative

Protein phosphatase 1G

UniProt

Q61074

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_032040.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QSKISQRDENGELRLLSSIVEELLDQCLAPDTSGDGTGCDNMTCIIICFK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fibronectin Polyclonal Antibody
E-AB-68404-01 60 µL

Fibronectin Polyclonal Antibody

Sign In for Pricing
View Details
Fibronectin Polyclonal Antibody
E-AB-68404-02 120 µL

Fibronectin Polyclonal Antibody

Sign In for Pricing
View Details
Fibronectin Polyclonal Antibody
E-AB-68404-03 200 µL

Fibronectin Polyclonal Antibody

Sign In for Pricing
View Details
alpha Synuclein (SNCA) Mouse Monoclonal Antibody [Clone ID: AT1E10]
AM50030PU-S 50 µL

alpha Synuclein (SNCA) Mouse Monoclonal Antibody [Clone ID: AT1E10]

Sign In for Pricing
View Details
Frozen Tissue Sections, Parotid gland
CS628955 5x 5 µm

Frozen Tissue Sections, Parotid gland

Sign In for Pricing
View Details
3-Bromopentane-2,4-dione
TRC-B804185-1G 1 g

3-Bromopentane-2,4-dione

Sign In for Pricing
View Details