Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DTNA Peptide - middle region

DTNA Peptide - middle region

Product Specifications

Product Name Alternative

Dtn, adbn, DTN-A, a-DB-1, Gm19389, 2210407P21Rik

UniProt

Q9D2N4

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001272736.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DCFWRGHAGGSHSNQHQMKEYTSWKSPAKKLTNALSKSLSCASSREPLHP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human ZNF710 activation kit by CRISPRa
GA117773 1 Kit

Human ZNF710 activation kit by CRISPRa

Sign In for Pricing
View Details
P Glycoprotein (ABCB1) Mouse Monoclonal Antibody [Clone ID: OTI11D2]
CF806689 100 µg

P Glycoprotein (ABCB1) Mouse Monoclonal Antibody [Clone ID: OTI11D2]

Sign In for Pricing
View Details
CD79a (IGA/515), CF568 conjugate, 0.1mg/mL
BNC680515-500 1x 500 µL

CD79a (IGA/515), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant MERS-CoV Spike/S2 Protein (S2 Subunit, aa 726-1296, His Tag)
PKSV030243 100 µg

Recombinant MERS-CoV Spike/S2 Protein (S2 Subunit, aa 726-1296, His Tag)

Sign In for Pricing
View Details
gamma Adducin (ADD3) Human Gene Knockout Kit (CRISPR)
KN209129LP 1 Kit

gamma Adducin (ADD3) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Hepes
TRC-H998468-2.5G 2.5 g

Hepes

Sign In for Pricing
View Details