Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DTNA Peptide - middle region

DTNA Peptide - middle region

Product Specifications

Product Name Alternative

Dtn, adbn, DTN-A, a-DB-1, Gm19389, 2210407P21Rik

UniProt

Q9D2N4

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001272736.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DCFWRGHAGGSHSNQHQMKEYTSWKSPAKKLTNALSKSLSCASSREPLHP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MIF Polyclonal Antibody
E-AB-40456-01 25 µL

MIF Polyclonal Antibody

Sign In for Pricing
View Details
MIF Polyclonal Antibody
E-AB-40456-02 100 µL

MIF Polyclonal Antibody

Sign In for Pricing
View Details
Tissue FFPE Sections, Ovary: right
CS804819 5x 5 µm

Tissue FFPE Sections, Ovary: right

Sign In for Pricing
View Details
2-Allyl-2-phenyl-4-pentenenitrile
TRC-A549215-2.5G 2.5 g

2-Allyl-2-phenyl-4-pentenenitrile

Sign In for Pricing
View Details
BRCA1 Human Gene Knockout Kit (CRISPR)
KN218505RB 1 Kit

BRCA1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Neurofilament Heavy Polypeptide Antibody
KC-1190-01 50 μL

Neurofilament Heavy Polypeptide Antibody

Sign In for Pricing
View Details