Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TMOD1 Peptide - middle region

TMOD1 Peptide - middle region

Product Specifications

Product Name Alternative

Tropomodulin-1

UniProt

P49813

Field of Research

Musculoskeletal & Connective Tissue Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_068683.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: APTGPFKREELLDHLEKQAKEFKDREDLVPYTGEKRGKVWVPKQKPMDPV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PEPT1 Rabbit Polyclonal Antibody (BF647)
orb1598110 100 µL

PEPT1 Rabbit Polyclonal Antibody (BF647)

Sign In for Pricing
View Details
Synpo (NM_001109975) Mouse Tagged ORF Clone
MG215248 10 µg

Synpo (NM_001109975) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Phospho-ROCK1 (Ser282) Peptide
AF4304-BP 1 mg

Phospho-ROCK1 (Ser282) Peptide

Sign In for Pricing
View Details
CDS1 (MaxLight 650)
MBS6468530-01 0.1 mL

CDS1 (MaxLight 650)

Sign In for Pricing
View Details
CDS1 (MaxLight 650)
MBS6468530-02 5x 0.1 mL

CDS1 (MaxLight 650)

Sign In for Pricing
View Details
Rtn4rl1 Rat shRNA Plasmid (Locus ID 303311)
TL713523 1 Kit

Rtn4rl1 Rat shRNA Plasmid (Locus ID 303311)

Sign In for Pricing
View Details