TMOD1 Peptide - middle region
TMOD1 Peptide - middle region
Product Specifications
Product Name Alternative
Tropomodulin-1
UniProt
P49813
Field of Research
Musculoskeletal & Connective Tissue Research
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_068683.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: APTGPFKREELLDHLEKQAKEFKDREDLVPYTGEKRGKVWVPKQKPMDPV
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
APRab12043-01 20 µL
Histamine H3 Receptor Rabbit Polyclonal Antibody
Sign In for Pricing
View Details APRab12043-02 50 µL
Histamine H3 Receptor Rabbit Polyclonal Antibody
Sign In for Pricing
View Details APRab12043-03 100 µL
Histamine H3 Receptor Rabbit Polyclonal Antibody
Sign In for Pricing
View Details APRab12043-04 200 µL
Histamine H3 Receptor Rabbit Polyclonal Antibody
Sign In for Pricing
View Details 
T5595-0005B 1 Kit
Tissue Set, HisTekTM, DNA, RNA, Protein, Human Adult Normal, Uterus discontinued
Sign In for Pricing
View Details