Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DAXX Peptide - C-terminal region

DAXX Peptide - C-terminal region

Product Specifications

UniProt

O35613

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001186662.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GSGLLGNSYIKEPMAQQDSGQNTSVQPMPSPPLASVASVADSSTRVDSPS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human Cathepsin L/CTSL Protein (His Tag)
PKSH032182-01 10 µg

Recombinant Human Cathepsin L/CTSL Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human Cathepsin L/CTSL Protein (His Tag)
PKSH032182-02 50 µg

Recombinant Human Cathepsin L/CTSL Protein (His Tag)

Sign In for Pricing
View Details
Tryptophanyl tRNA synthetase/WRS Antibody
OC-424-01 50 μL

Tryptophanyl tRNA synthetase/WRS Antibody

Sign In for Pricing
View Details
Tryptophanyl tRNA synthetase/WRS Antibody
OC-424-02 100 µL

Tryptophanyl tRNA synthetase/WRS Antibody

Sign In for Pricing
View Details
Tryptophanyl tRNA synthetase/WRS Antibody
OC-424-03 1 mL

Tryptophanyl tRNA synthetase/WRS Antibody

Sign In for Pricing
View Details
WNT5A (NM_003392) Human Over-expression Lysate
LC401155 20 µg

WNT5A (NM_003392) Human Over-expression Lysate

Sign In for Pricing
View Details