Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DAXX Peptide - C-terminal region

DAXX Peptide - C-terminal region

Product Specifications

UniProt

O35613

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001186662.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GSGLLGNSYIKEPMAQQDSGQNTSVQPMPSPPLASVASVADSSTRVDSPS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Prostate
CS706978 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details
Cytokeratin 7 (KRT7/760 + OV-TL12/30), 0.2mg/mL
BNUB1167-500 1x 500 µL

Cytokeratin 7 (KRT7/760 + OV-TL12/30), 0.2mg/mL

Sign In for Pricing
View Details
Myelin Basic Protein (MBP) (NM_001025081) Human Over-expression Lysate
LY422581 100 µg

Myelin Basic Protein (MBP) (NM_001025081) Human Over-expression Lysate

Sign In for Pricing
View Details
Carbonic Anhydrase I (CA1) (166-176) Goat Polyclonal Antibody
AP23069PU-N 50 µg

Carbonic Anhydrase I (CA1) (166-176) Goat Polyclonal Antibody

Sign In for Pricing
View Details
General Reverse Triiodothyronine (rT3) ELISA Kit
RDR-rT3-Ge-01 96 Tests

General Reverse Triiodothyronine (rT3) ELISA Kit

Sign In for Pricing
View Details
General Reverse Triiodothyronine (rT3) ELISA Kit
RDR-rT3-Ge-02 48 Tests

General Reverse Triiodothyronine (rT3) ELISA Kit

Sign In for Pricing
View Details