TOMM40 Peptide - middle region
TOMM40 Peptide - middle region
Product Specifications
Product Name Alternative
TOM40, PEREC1, C19orf1, PER-EC1, D19S1177E
UniProt
O96008
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_001122388.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: QSKFVNWQVDGEYRGSDFTAAVTLGNPDVLVGSGILVAHYLQSITPCLAL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
GTR10396327 96 Well
Guinea Pig Cytotoxic and regulatory T cell molecule (CRTAM) ELISA kit
Sign In for Pricing
View Details 
197029 1 Pack (1 Panel (s) x 1 Pack)
P/P042/FR613/PE-150X50-1 Prohibited Activity Signs & Labels (Adhesive)
Sign In for Pricing
View Details