Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TOMM40 Peptide - middle region

TOMM40 Peptide - middle region

Product Specifications

Product Name Alternative

TOM40, PEREC1, C19orf1, PER-EC1, D19S1177E

UniProt

O96008

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001122388.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QSKFVNWQVDGEYRGSDFTAAVTLGNPDVLVGSGILVAHYLQSITPCLAL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ACVRL1 Protein (C-His, Human)
P500237 100 µg

ACVRL1 Protein (C-His, Human)

Sign In for Pricing
View Details
Anti-Human CFP/Properdin Antibody (SAA1485)
MBS1570431-01 0.1 mg

Anti-Human CFP/Properdin Antibody (SAA1485)

Sign In for Pricing
View Details
Anti-Human CFP/Properdin Antibody (SAA1485)
MBS1570431-02 1 mg

Anti-Human CFP/Properdin Antibody (SAA1485)

Sign In for Pricing
View Details
Anti-Human CFP/Properdin Antibody (SAA1485)
MBS1570431-03 5x 1 mg

Anti-Human CFP/Properdin Antibody (SAA1485)

Sign In for Pricing
View Details
Tpd52 (NM_009412) Mouse Recombinant Protein
E45M48521M5 20 µg

Tpd52 (NM_009412) Mouse Recombinant Protein

Sign In for Pricing
View Details
keratin 40 (KRT40) (NM_182497) Human Tagged ORF Clone
RC222348 10 µg

keratin 40 (KRT40) (NM_182497) Human Tagged ORF Clone

Sign In for Pricing
View Details