Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TLE1 Peptide - middle region

TLE1 Peptide - middle region

Product Specifications

Product Name Alternative

Grg1, Grg-1, Tle4l, Estm14, C230057C06Rik

UniProt

Q62440

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001272459.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VPDSLRSTDKRRNGPEFSSDIKKRKVDDKDNYDSDGDKSDDNLVVDVSNE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LRRC45 Double Nickase Plasmid (m2)
sc-432214-NIC-2 20 µg

LRRC45 Double Nickase Plasmid (m2)

Sign In for Pricing
View Details
MLLT6 Antibody (C-term) Blocking Peptide
MBS9225946-01 0.5 mg

MLLT6 Antibody (C-term) Blocking Peptide

Sign In for Pricing
View Details
MLLT6 Antibody (C-term) Blocking Peptide
MBS9225946-02 5x 0.5 mg

MLLT6 Antibody (C-term) Blocking Peptide

Sign In for Pricing
View Details
Vasopressin [d(CH2)51, D-Ile2, Ile4, Arg8]
MBS658886-01 1 mg

Vasopressin [d(CH2)51, D-Ile2, Ile4, Arg8]

Sign In for Pricing
View Details
Vasopressin [d(CH2)51, D-Ile2, Ile4, Arg8]
MBS658886-02 5x 1 mg

Vasopressin [d(CH2)51, D-Ile2, Ile4, Arg8]

Sign In for Pricing
View Details
JAKMIP1 (NM_144720) Human 3' UTR Clone
SC202672 10 µg

JAKMIP1 (NM_144720) Human 3' UTR Clone

Sign In for Pricing
View Details