TLE1 Peptide - middle region
TLE1 Peptide - middle region
Product Specifications
Product Name Alternative
Grg1, Grg-1, Tle4l, Estm14, C230057C06Rik
UniProt
Q62440
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_001272459.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: VPDSLRSTDKRRNGPEFSSDIKKRKVDDKDNYDSDGDKSDDNLVVDVSNE
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
TMPH-00169-01 5 µg
PBP 3 Protein, Bacillus subtilis, Recombinant (His)
Sign In for Pricing
View Details TMPH-00169-02 10 µg
PBP 3 Protein, Bacillus subtilis, Recombinant (His)
Sign In for Pricing
View Details TMPH-00169-03 20 µg
PBP 3 Protein, Bacillus subtilis, Recombinant (His)
Sign In for Pricing
View Details TMPH-00169-04 50 µg
PBP 3 Protein, Bacillus subtilis, Recombinant (His)
Sign In for Pricing
View Details TMPH-00169-05 100 µg
PBP 3 Protein, Bacillus subtilis, Recombinant (His)
Sign In for Pricing
View Details TMPH-00169-06 200 µg
PBP 3 Protein, Bacillus subtilis, Recombinant (His)
Sign In for Pricing
View Details