What is the catalog number for IPO5 Peptide - N-terminal region?

The catalog number for IPO5 Peptide - N-terminal region is orb1998057.

What sizes are available for IPO5 Peptide - N-terminal region?

IPO5 Peptide - N-terminal region is available in the following size(s): 100 µg.

Is IPO5 Peptide - N-terminal region in stock?

IPO5 Peptide - N-terminal region is currently made to order / not held in immediate stock. Contact us for lead time.

IPO5 Peptide - N-terminal region

Product Specifications

Product Name Alternative

IMB3, Pse1, imp5, KPNB3, RANBP5

UniProt

O00410

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_002262.3

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SDVQTAIKSELLMIIQMETQSSMRKKVCDIAAELARNLIDEDGNNQWPEG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

sc-412006-ACT-2 20 µg

ACSVL2 CRISPR Activation Plasmid (h2)

Sign In for Pricing

View Details

RP010072 100 µg

E2F3 Recombinant Protein (Human)

Sign In for Pricing

View Details

MG200589 10 µg

BC024416 Mouse Tagged ORF Clone

Sign In for Pricing

View Details

NU-811-550 80 µL

8- (6-Aminohexyl) -amino-adenosine-3',5'-bisphosphate-ATTO-550

Sign In for Pricing

View Details

TL506364V 500 µL Each

Galnt17 Mouse shRNA Lentiviral Particle (Locus ID 212996)

Sign In for Pricing

View Details

sc-108747-V 200 µL

2410022L05Rik shRNA (m) Lentiviral Particles

Sign In for Pricing

View Details