Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PDE1A Peptide - C-terminal region

PDE1A Peptide - C-terminal region

Product Specifications

Product Name Alternative

HCAM1, HCAM-1, HSPDE1A, CAM-PDE-1A

UniProt

P54750

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001003683.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ALRRSNTKGSMSDGSYSPDYSLAAVDLKSFKNNLVDIIQQNKERWKELAA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BAP1 (BRCA1 Associated Protein 1) (BAP1/2432), CF640R conjugate, 0.1mg/mL
BNC402432-100 1x 100 µL

BAP1 (BRCA1 Associated Protein 1) (BAP1/2432), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
AKR1D1 (NM_005989) Human Recombinant Protein
TP323056M 100 µg

AKR1D1 (NM_005989) Human Recombinant Protein

Sign In for Pricing
View Details
HAO1 Monoclonal Antibody
E-AB-22108-01 20 µL

HAO1 Monoclonal Antibody

Sign In for Pricing
View Details
HAO1 Monoclonal Antibody
E-AB-22108-02 60 µL

HAO1 Monoclonal Antibody

Sign In for Pricing
View Details
HAO1 Monoclonal Antibody
E-AB-22108-03 120 µL

HAO1 Monoclonal Antibody

Sign In for Pricing
View Details
HAO1 Monoclonal Antibody
E-AB-22108-04 200 µL

HAO1 Monoclonal Antibody

Sign In for Pricing
View Details