Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PDE1A Peptide - C-terminal region

PDE1A Peptide - C-terminal region

Product Specifications

Product Name Alternative

HCAM1, HCAM-1, HSPDE1A, CAM-PDE-1A

UniProt

P54750

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001003683.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ALRRSNTKGSMSDGSYSPDYSLAAVDLKSFKNNLVDIIQQNKERWKELAA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AF/LE Purified Anti-Rat CD4 (domain 1) Antibody[OX-38]
E-AB-F11050-01 100 µg

AF/LE Purified Anti-Rat CD4 (domain 1) Antibody[OX-38]

Sign In for Pricing
View Details
AF/LE Purified Anti-Rat CD4 (domain 1) Antibody[OX-38]
E-AB-F11050-02 1 mg

AF/LE Purified Anti-Rat CD4 (domain 1) Antibody[OX-38]

Sign In for Pricing
View Details
AF/LE Purified Anti-Rat CD4 (domain 1) Antibody[OX-38]
E-AB-F11050-03 5 mg

AF/LE Purified Anti-Rat CD4 (domain 1) Antibody[OX-38]

Sign In for Pricing
View Details
AF/LE Purified Anti-Rat CD4 (domain 1) Antibody[OX-38]
E-AB-F11050-04 25 mg

AF/LE Purified Anti-Rat CD4 (domain 1) Antibody[OX-38]

Sign In for Pricing
View Details
AF/LE Purified Anti-Rat CD4 (domain 1) Antibody[OX-38]
E-AB-F11050-05 50 mg

AF/LE Purified Anti-Rat CD4 (domain 1) Antibody[OX-38]

Sign In for Pricing
View Details
AF/LE Purified Anti-Rat CD4 (domain 1) Antibody[OX-38]
E-AB-F11050-06 100 mg

AF/LE Purified Anti-Rat CD4 (domain 1) Antibody[OX-38]

Sign In for Pricing
View Details