Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CASP1 Peptide - middle region

CASP1 Peptide - middle region

Product Specifications

Product Name Alternative

ICE, Il1bc

UniProt

P29452

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_033937.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: IEKDFIAFCSSTPDNVSWRHPVRGSLFIESLIKHMKEYAWSCDLEDIFRK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

POET10 BacMAM
200137 10 µg

POET10 BacMAM

Sign In for Pricing
View Details
VPS29 siRNA (Mouse)
CRM5796-01 15 nmol

VPS29 siRNA (Mouse)

Sign In for Pricing
View Details
VPS29 siRNA (Mouse)
CRM5796-02 30 nmol

VPS29 siRNA (Mouse)

Sign In for Pricing
View Details
Recombinant Bacillus subtilis 1,4-Dihydroxy-2-naphthoyl-CoA synthase (menB)
MBS1139118-01 0.02 mg (E-Coli)

Recombinant Bacillus subtilis 1,4-Dihydroxy-2-naphthoyl-CoA synthase (menB)

Sign In for Pricing
View Details
Recombinant Bacillus subtilis 1,4-Dihydroxy-2-naphthoyl-CoA synthase (menB)
MBS1139118-02 0.02 mg (Yeast)

Recombinant Bacillus subtilis 1,4-Dihydroxy-2-naphthoyl-CoA synthase (menB)

Sign In for Pricing
View Details
Recombinant Bacillus subtilis 1,4-Dihydroxy-2-naphthoyl-CoA synthase (menB)
MBS1139118-03 0.1 mg (E-Coli)

Recombinant Bacillus subtilis 1,4-Dihydroxy-2-naphthoyl-CoA synthase (menB)

Sign In for Pricing
View Details