Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CASP1 Peptide - middle region

CASP1 Peptide - middle region

Product Specifications

Product Name Alternative

ICE, Il1bc

UniProt

P29452

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_033937.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: IEKDFIAFCSSTPDNVSWRHPVRGSLFIESLIKHMKEYAWSCDLEDIFRK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-BIVM Antibody
CTA1978-01 30 µL

Anti-BIVM Antibody

Sign In for Pricing
View Details
Anti-BIVM Antibody
CTA1978-02 50 μL

Anti-BIVM Antibody

Sign In for Pricing
View Details
Anti-BIVM Antibody
CTA1978-03 100 µL

Anti-BIVM Antibody

Sign In for Pricing
View Details
Anti-BIVM Antibody
CTA1978-04 200 µL

Anti-BIVM Antibody

Sign In for Pricing
View Details
HIST1H3/2H3/3H3/H3F3 Antibody (C-term)
MBS9211213-01 0.08 mL

HIST1H3/2H3/3H3/H3F3 Antibody (C-term)

Sign In for Pricing
View Details
HIST1H3/2H3/3H3/H3F3 Antibody (C-term)
MBS9211213-02 0.4 mL

HIST1H3/2H3/3H3/H3F3 Antibody (C-term)

Sign In for Pricing
View Details