NTRK1 Peptide - middle region
NTRK1 Peptide - middle region
Product Specifications
Product Name Alternative
MTC, TRK, TRK1, TRKA, Trk-A, p140-TrkA
UniProt
P04629
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_001007793.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: LQHQHIVRFFGVCTEGRPLLMVFEYMRHGDLNRFLRSHGPDAKLLAGGED
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
AAP59147-100UG 100 µg
Nfatc2 Peptide - N-terminal region (AAP59147)
Sign In for Pricing
View Details 
bs-13010R-BF750 100 µL
DMC1 Polyclonal Antibody, AbBy Fluor™ 750 Conjugated
Sign In for Pricing
View Details