Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

USF2 Peptide - middle region

USF2 Peptide - middle region

Product Specifications

Product Name Alternative

Usf-2, bHLHb12

UniProt

Q64705

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_035810.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GTRTPRDERRRAQHNEVERRRRDKINNWIVQLSKIIPDCHADNSKTGASK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NFKBIE Polyclonal Antibody
E-AB-92870-01 60 µL

NFKBIE Polyclonal Antibody

Sign In for Pricing
View Details
NFKBIE Polyclonal Antibody
E-AB-92870-02 120 µL

NFKBIE Polyclonal Antibody

Sign In for Pricing
View Details
NFKBIE Polyclonal Antibody
E-AB-92870-03 200 µL

NFKBIE Polyclonal Antibody

Sign In for Pricing
View Details
MOrange Antibody
orb688470-01 50 µg

MOrange Antibody

Sign In for Pricing
View Details
MOrange Antibody
orb688470-02 100 µg

MOrange Antibody

Sign In for Pricing
View Details
Lentiviral human HOXC5 shRNA (UAS) - Lentiviral human HOXC5 shRNA (UAS, GFP) (100)
GTR15147237 1 Vial

Lentiviral human HOXC5 shRNA (UAS) - Lentiviral human HOXC5 shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details