What is the catalog number for GJA3 Peptide - C-terminal region?

The catalog number for GJA3 Peptide - C-terminal region is orb1998041.

What sizes are available for GJA3 Peptide - C-terminal region?

GJA3 Peptide - C-terminal region is available in the following size(s): 100 µg.

Is GJA3 Peptide - C-terminal region in stock?

GJA3 Peptide - C-terminal region is currently made to order / not held in immediate stock. Contact us for lead time.

GJA3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

Cx43, Cx46, Cnx46, Gja-3

UniProt

Q64448

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001258552.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LQESALVVTPEEGEQALATTVEMHSPPLVLLDPGRSSKSSNGRARPGDLA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BT-AP09651-01 20 µL

ZBP-89 Polyclonal Antibody

Sign In for Pricing

View Details

BT-AP09651-02 50 µL

ZBP-89 Polyclonal Antibody

Sign In for Pricing

View Details

BT-AP09651-03 100 µL

ZBP-89 Polyclonal Antibody

Sign In for Pricing

View Details

K0994907 1.0 µg DNA

HSF1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

Sign In for Pricing

View Details

orb1443636 500 µg

FLIP1 Antibody Blocking peptide

Sign In for Pricing

View Details

FAB9369JF669 0.1 mL

Rabbit Monoclonal FANCD2 Antibody (1290D) [Janelia Fluor 669]

Sign In for Pricing

View Details