Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SEPT8 Peptide - N-terminal region

SEPT8 Peptide - N-terminal region

Product Specifications

Product Name Alternative

45171

UniProt

Q92599

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001092281.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TDLERFSNAEPEPRSLSLGGHVGFDSLPDQLVSKSVTQGFSFNILCVGET

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human MS4A10 activation kit by CRISPRa
GA117508 1 Kit

Human MS4A10 activation kit by CRISPRa

Sign In for Pricing
View Details
p107 (RBL1) Mouse Monoclonal Antibody [Clone ID: OTI4E1]
CF811337 100 µg

p107 (RBL1) Mouse Monoclonal Antibody [Clone ID: OTI4E1]

Sign In for Pricing
View Details
Mouse IL-33, Tag Free
HA210768-01 20 µg

Mouse IL-33, Tag Free

Sign In for Pricing
View Details
Mouse IL-33, Tag Free
HA210768-02 50 µg

Mouse IL-33, Tag Free

Sign In for Pricing
View Details
Mouse IL-33, Tag Free
HA210768-03 100 µg

Mouse IL-33, Tag Free

Sign In for Pricing
View Details
Alpha-Farnesene (>80%)
TRC-F102425-25MG 25 mg

Alpha-Farnesene (>80%)

Sign In for Pricing
View Details