Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SEPT8 Peptide - N-terminal region

SEPT8 Peptide - N-terminal region

Product Specifications

Product Name Alternative

45171

UniProt

Q92599

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001092281.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TDLERFSNAEPEPRSLSLGGHVGFDSLPDQLVSKSVTQGFSFNILCVGET

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IL31RA (NM_139017) Human Recombinant Protein
TP318212 20 µg

IL31RA (NM_139017) Human Recombinant Protein

Sign In for Pricing
View Details
CBL (NM_005188) Human Over-expression Lysate
LC401588 20 µg

CBL (NM_005188) Human Over-expression Lysate

Sign In for Pricing
View Details
Bedaquiline-d6 (Mixture of Diastereomers)
TRC-B119552-5MG 5 mg

Bedaquiline-d6 (Mixture of Diastereomers)

Sign In for Pricing
View Details
Chromogranin A / CHGA (Neuroendocrine Marker), CF640R conjugate, 0.1mg/mL
BNC401774-100 1x 100 µL

Chromogranin A / CHGA (Neuroendocrine Marker), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human FOG1 (ZFPM1) activation kit by CRISPRa
GA116037 1 Kit

Human FOG1 (ZFPM1) activation kit by CRISPRa

Sign In for Pricing
View Details
Tissue FFPE Sections, Kidney
CS704805 5x 5 µm

Tissue FFPE Sections, Kidney

Sign In for Pricing
View Details