Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EPS15 Peptide - C-terminal region

EPS15 Peptide - C-terminal region

Product Specifications

Product Name Alternative

AF1P, AF-1P, MLLT5

UniProt

P42566

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001153441.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KLNDPFQPFPGNDSPKEKDPEIFCDPFTSATTTTNKEADPSNFANFSAYP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2-Iodophenol
TRC-I717500-100G 100 g

2-Iodophenol

Sign In for Pricing
View Details
PIRC103 Recombinant Protein (Human)
RP083346 100 µg

PIRC103 Recombinant Protein (Human)

Sign In for Pricing
View Details
SERPINB3 Polyclonal Antibody, PerCP Conjugated
bs-9214R-PerCP 100 µL

SERPINB3 Polyclonal Antibody, PerCP Conjugated

Sign In for Pricing
View Details
(Acetylamino) [ (3-methoxy-5-methyl-4-isoxazolyl) methyl]propanedioic Acid Diethyl Ester
440870 10 mg

(Acetylamino) [ (3-methoxy-5-methyl-4-isoxazolyl) methyl]propanedioic Acid Diethyl Ester

Sign In for Pricing
View Details
Annexin VII (ANXA7) Human qPCR Primer Pair (NM_004034)
HP225787 200 Reactions

Annexin VII (ANXA7) Human qPCR Primer Pair (NM_004034)

Sign In for Pricing
View Details
CELSR2 (Cadherin EGF LAG Seven-pass G-type Receptor 2, Cadherin Family Member 10, CDHF10, Epidermal Growth Factor-like Protein 2, EGF-like Protein 2, EGFL2, Flamingo Homolog 3, Flamingo1, KIAA0279, Multiple Epidermal Growth Factor-like Domains Protein 3, Multiple EGF-like Domains Protein 3, MEGF3)
170297 50 µg

CELSR2 (Cadherin EGF LAG Seven-pass G-type Receptor 2, Cadherin Family Member 10, CDHF10, Epidermal Growth Factor-like Protein 2, EGF-like Protein 2, EGFL2, Flamingo Homolog 3, Flamingo1, KIAA0279, Multiple Epidermal Growth Factor-like Domains Protein 3, Multiple EGF-like Domains Protein 3, MEGF3)

Sign In for Pricing
View Details