Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

STK3 Peptide - middle region

STK3 Peptide - middle region

Product Specifications

Product Name Alternative

KRS1, MST2

UniProt

Q13188

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001243241.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GTMKRNATSPQVQRPSFMDYFDKQDFKNKSHENCNQNMHEPFPMSKNVFP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PARP Antibody
F47592-0.08ML 0.08 mL

PARP Antibody

Sign In for Pricing
View Details
Fexofenadine N-Oxide (~85%)
TRC-F322560-25MG 25 mg

Fexofenadine N-Oxide (~85%)

Sign In for Pricing
View Details
Sodium 2,2-Dichloroacetate-2-13C
TRC-D431839-5MG 5 mg

Sodium 2,2-Dichloroacetate-2-13C

Sign In for Pricing
View Details
OR52E1 Antibody
8G460-AAT 50 µg

OR52E1 Antibody

Sign In for Pricing
View Details
PE Anti-Mouse CD326/EpCAM Antibody[G8.8]
E-AB-F1181UD-01 25 µg

PE Anti-Mouse CD326/EpCAM Antibody[G8.8]

Sign In for Pricing
View Details
PE Anti-Mouse CD326/EpCAM Antibody[G8.8]
E-AB-F1181UD-02 100 µg

PE Anti-Mouse CD326/EpCAM Antibody[G8.8]

Sign In for Pricing
View Details