Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

STK3 Peptide - middle region

STK3 Peptide - middle region

Product Specifications

Product Name Alternative

KRS1, MST2

UniProt

Q13188

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001243241.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GTMKRNATSPQVQRPSFMDYFDKQDFKNKSHENCNQNMHEPFPMSKNVFP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human PRP19 (PRPF19) activation kit by CRISPRa
GA109131 1 Kit

Human PRP19 (PRPF19) activation kit by CRISPRa

Sign In for Pricing
View Details
ZFYVE27 (NM_001174121) Human Over-expression Lysate
LY432865 100 µg

ZFYVE27 (NM_001174121) Human Over-expression Lysate

Sign In for Pricing
View Details
GnRH-Receptor / LH-RH Receptor (GNRHR/2982R), CF568 conjugate, 0.1mg/mL
BNC682982-500 1x 500 µL

GnRH-Receptor / LH-RH Receptor (GNRHR/2982R), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
OCIAD1 (NM_001079839) Human Over-expression Lysate
LY421553 100 µg

OCIAD1 (NM_001079839) Human Over-expression Lysate

Sign In for Pricing
View Details
IMPDH1 (NM_001142575) Human Over-expression Lysate
LC428185 20 µg

IMPDH1 (NM_001142575) Human Over-expression Lysate

Sign In for Pricing
View Details
AATOM™ 610 azide
70253-AAT 1 mg

AATOM™ 610 azide

Sign In for Pricing
View Details