CTSL Peptide - middle region
CTSL Peptide - middle region
Product Specifications
Product Name Alternative
Fs, MEP, nkt, CatL, Ctsl1, 1190035F06Rik
UniProt
P06797
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_034114.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: AMDASHPSLQFYSSGIYYEPNCSSKNLDHGVLLVGYGYEGTDSNKNKYWL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
K6813202 1.0 µg DNA
Clcn7 sgRNA CRISPR Lentivector (Rat) (Target 1)
Sign In for Pricing
View Details 
302291-AP 200 µL
BCL6B (B-Cell CLL/lymphoma 6 Member B Protein, Bcl6-Associated Zinc Finger Protein, Zinc Finger Protein 62, BCL6B, BAZF, ZNF62) (AP) discontinued
Sign In for Pricing
View Details